2.17 Rating by CuteStat

utssa.com is 8 years 7 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. Furthermore the website is monetizing from Google Adsense. As no active threats were reported recently by users, utssa.com is SAFE to browse.

PageSpeed Score
90
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.31.85.83

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
News Travel Blog -

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 10 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: pub-1457119046652778 Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 104.31.85.83)

Welcome to nginx!

- kurort-zu-hause.de
Not Applicable $ 8.95

contagerencianet.com.br | 522: Connection timed out

- contagerencianet.com.br
Not Applicable $ 8.95


En Yeni Dekor Mobilya Modelleri

- dekormobilyam3.com

Mobilya Dekoratif modellerinin en iyileri

Not Applicable $ 8.95

Wrinkle Miracle - Discover a $5 Solution to a Wrinkle Free Face

- skinimpracticalsympathy.review
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 28 Oct 2015 04:33:32 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
X-Pingback: http://utssa.com/xmlrpc.php
Server: cloudflare-nginx
CF-RAY: 23c3ec4e2f5207a9-MIA
Content-Encoding: gzip

Domain Information

Domain Registrar: Camelot 93, LLC
Registration Date: Sep 26, 2015, 12:00 AM 8 years 7 months 2 weeks ago
Last Modified: Sep 27, 2015, 12:00 AM 8 years 7 months 2 weeks ago
Expiration Date: Sep 26, 2016, 12:00 AM 7 years 7 months 3 weeks ago
Domain Status:
ok

Domain Nameserver Information

Host IP Address Country
rob.ns.cloudflare.com 173.245.59.140 United States of America United States of America
gina.ns.cloudflare.com 108.162.192.117 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
utssa.com A 299 IP: 104.31.85.83
utssa.com A 299 IP: 104.31.84.83
utssa.com NS 21599 Target: rob.ns.cloudflare.com
utssa.com NS 21599 Target: gina.ns.cloudflare.com
utssa.com SOA 21599 MNAME: gina.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2019504639
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
utssa.com MX 299 Priority: 20
Target: mx2.zoho.com
utssa.com MX 299 Priority: 10
Target: mx.zoho.com

Full WHOIS Lookup

Domain Name: utssa.com
Registry Domain ID: 1963819498_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.melbourneit.com
Registrar URL: http://www.melbourneit.com.au
Updated Date: 2015-09-27T04:52:45Z
Creation Date: 2015-09-26T17:27:06Z
Registrar Registration Expiration Date: 2016-09-26T17:27:06Z
Registrar: Melbourne IT Ltd
Registrar IANA ID: 13
Registrar Abuse Contact Email: abuse@melbourneit.com.au
Registrar Abuse Contact Phone: +61.386242300
Domain Status: ok
Registry Registrant ID:
Registrant Name: Hildegard Ryan
Registrant Organization: Hildegard Ryan
Registrant Street: 4889 Gore Street
Registrant City: Houston
Registrant State/Province: TX
Registrant Postal Code: 77020
Registrant Country: US
Registrant Phone: +1.7135153582
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: maryamfordham25475046@gmail.com
Registry Admin ID:
Admin Name: Hildegard Ryan
Admin Organization: Hildegard Ryan
Admin Street: 4889 Gore Street
Admin City: Houston
Admin State/Province: TX
Admin Postal Code: 77020
Admin Country: US
Admin Phone: +1.7135153582
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: maryamfordham25475046@gmail.com
Registry Tech ID:
Tech Name: Hildegard Ryan
Tech Organization: Hildegard Ryan
Tech Street: 4889 Gore Street
Tech City: Houston
Tech State/Province: TX
Tech Postal Code: 77020
Tech Country: US
Tech Phone: +1.7135153582
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: maryamfordham25475046@gmail.com
Name Server: GINA.NS.CLOUDFLARE.COM
Name Server: ROB.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdrprs.internic.net
>>> Last update of WHOIS database: 2015-10-28T04:20:31Z

TERMS OF USE OF MELBOURNE IT WHOIS DATABASE
The WHOIS database is operated by Melbourne IT Ltd ('we', 'our' or 'us'). Your access to, and use of, our WHOIS database and the information made available on our WHOIS database is subject to these Terms of Use and our Privacy Policy. All information contained in our WHOIS database is provided 'as is'. We take no responsibility for any error or omission in our WHOIS database. The data in our WHOIS database is provided to you for your information only. You may use the information in our WHOIS database only for the purpose of obtaining information about or related to a domain name registration record ('Permitted Purpose'). You agree not to use high-volume, automated electronic processes to access or query our WHOIS database. By submitting a WHOIS query to us, you agree that you will only use the data obtained from a WHOIS query for the Permitted Purpose and for lawful purposes, and that you will not: (a) allow, enable, or otherwise support the transmission of mass, unsolicited, commercial advertising or solicitations by e-mail, telephone, or facsimile; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of any Registry Operator or ICANN-Accredited registrar, except as reasonably necessary to register domain names or modify existing domain name registrations. You also agree that the copying, reproduction, translation, compilation, re-packaging, dissemination or other use of the data in our WHOIS database is prohibited without our prior written consent. We reserve the right to terminate your access to our WHOIS database at any time, and for any reason, including (without limitation) if you fail to comply with any provision of these Terms of Use, or we consider that you are excessively querying our WHOIS database. These Terms of Use may be modified by us at any time without notice by our amending the Terms of Use on this web page. You agree that your use of our WHOIS database following any modification to these Terms of Use will constitute your acceptance of these Terms of Use (as modified from time to time).